PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn225201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HD-ZIP
Protein Properties Length: 257aa    MW: 28856.8 Da    PI: 8.8272
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn225201genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.2e-1871125256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++keq  +Lee F+++++++ +++  LA++l+L +rqV vWFqNrRa+ k
  Achn225201  71 RKKLRLSKEQAAVLEETFKEHSTLKPKQKVSLANQLNLRTRQVEVWFQNRRARTK 125
                 788899***********************************************98 PP

2HD-ZIP_I/II123.69.2e-4071160191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq+++LEe+F+e+++L+p++Kv+la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr+yd+l+een+rL+ke +eLr +l
   Achn225201  71 RKKLRLSKEQAAVLEETFKEHSTLKPKQKVSLANQLNLRTRQVEVWFQNRRARTKLKQTEVDCEYLKRCYDNLTEENRRLQKEANELR-AL 160
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.1E-16244IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.2E-1857121IPR009057Homeodomain-like
PROSITE profilePS5007117.13567127IPR001356Homeobox domain
SMARTSM003896.2E-1469131IPR001356Homeobox domain
SuperFamilySSF466891.71E-1770136IPR009057Homeodomain-like
PfamPF000467.7E-1671125IPR001356Homeobox domain
CDDcd000864.68E-1471128No hitNo description
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
PfamPF021838.9E-11127161IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.0E-24127170IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MDARSNLRGI DVNRRPSRVA ECEDEVGVSS PNSTISSVSG KREENGTERG WATGGCGGEE  60
EDDDGGDTAE RKKLRLSKEQ AAVLEETFKE HSTLKPKQKV SLANQLNLRT RQVEVWFQNR  120
RARTKLKQTE VDCEYLKRCY DNLTEENRRL QKEANELRAL KLSPQTYMHM NPPTTLTMCP  180
SCERVAVLPP PSPAAAIGIT RHLMPALHEA HGSHSPKFLL FLFTSPTFIK QEHRSSITKL  240
HKFLTVSQAI NVLVIH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119127RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002263193.16e-92PREDICTED: homeobox-leucine zipper protein HAT4
SwissprotP466024e-88HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A068UP958e-92A0A068UP95_COFCA; Uncharacterized protein
TrEMBLD7TG796e-92D7TG79_VITVI; Putative uncharacterized protein
STRINGVIT_00s0299g00100.t012e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.12e-72homeobox-leucine zipper protein 3